PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0060s0067.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 304aa    MW: 33163.9 Da    PI: 7.0233
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0060s0067.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-334599155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt +LHerFv+av qLGG++kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Kalax.0060s0067.1.p 45 KPRLRWTADLHERFVDAVGQLGGPNKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 99
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.09942102IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-3142100IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-2445100IPR006447Myb domain, plants
SuperFamilySSF466892.15E-1645101IPR009057Homeodomain-like
PfamPF002491.4E-74798IPR001005SANT/Myb domain
PfamPF143793.8E-15140184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MFPLLMQPHD GGLTPLGHGR DDIHGIGVCS YGVGDPCLVL TSDPKPRLRW TADLHERFVD  60
AVGQLGGPNK ATPKAIMRTM GVKGLTLFHL KSHLQKYRLG KQSGKDMCDI VKDGSYLIEV  120
PESNNSAPKL LTPDTNEGFE VKEALRAQME VQSKLHLQVE AEKHLQIRQD AERRYMAMLD  180
RACRMLADHY VGGAVIDADK DKSQCMDAKK LPSMTFTHDT VPSYALQPST TAGLHGLEEL  240
LPGLHAQRAD CSTESCLTSH DSSAGSRKRM LHADSVAQYL LWGEANMAMP NVSVSQGIAG  300
YST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224659.11e-127PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK55e-50APL_ARATH; Myb family transcription factor APL
TrEMBLM5WGF61e-126M5WGF6_PRUPE; Myb family transcription factor APL
TrEMBLA0A0B2S9411e-125A0A0B2S941_GLYSO; Myb family transcription factor APL
TrEMBLI1L0751e-125I1L075_SOYBN; Uncharacterized protein
STRINGGLYMA09G02030.11e-125(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.14e-65G2-like family protein